Metal ion: Difference between revisions

From The School of Biomedical Sciences Wiki
Jump to navigation Jump to search
No edit summary
Nnjm2 (talk | contribs)
Cleaned up reference.
Line 1: Line 1:
Metal ions are paramount for metabolic processes in living [[Organisms|organisms]]. The nature of [[Metabolic processes|metabolic processes]] depend on the [[Proteins|proteins]] involved, that are formed from [[Amino acids|amino acids]]. [[Cysteine|Cysteine]] is special as it can form complexs with metal ions due to its [[Thiol group|thiol group]] at the end of the R chain<ref>YCPSCRYPCFP RI, CPLCLFEFRE RT, TCPLCNAKLVY IE, QCPLCRCPVQ VS, PCPLCRVESLH CV, NVSCPQCRETFPQ RQ, DCNHSFCRACITLNYESNRNTDGKGNCPVCRVPYPF RI, ECPTCRKKLVS RS. A novel cysteine-rich sequence motif. Cell. 1991 Feb 8;64:483-4.</ref>. For example its ability to&nbsp;bind to [[Nickel|nickel ]]ions.
Metal ions are paramount for metabolic processes in living [[Organisms|organisms]]. The nature of [[Metabolic processes|metabolic processes]] depend on the [[Proteins|proteins]] involved, that are formed from [[Amino acids|amino acids]]. [[Cysteine|Cysteine]] is special as it can form complexes with metal ions due to its [[Thiol group|thiol group]] at the end of the R chain<ref> A novel cysteine-rich sequence motif. Cell. 1991 Feb 8;64:483-4.</ref>. For example its ability to&nbsp;bind to [[Nickel|nickel ions]].  


=== References  ===
=== References  ===


<references />
<references />

Revision as of 18:52, 17 October 2017

Metal ions are paramount for metabolic processes in living organisms. The nature of metabolic processes depend on the proteins involved, that are formed from amino acids. Cysteine is special as it can form complexes with metal ions due to its thiol group at the end of the R chain[1]. For example its ability to bind to nickel ions.

References

  1. A novel cysteine-rich sequence motif. Cell. 1991 Feb 8;64:483-4.