Metal ion

From The School of Biomedical Sciences Wiki
Revision as of 14:52, 17 October 2017 by 160094561 (Talk | contribs)
Jump to: navigation, search

Metal ions are paramount for metabolic processes in living organisms. The nature of metabolic processes depend on the proteins involved, that are formed from amino acids. Cysteine is special as it can form complexs with metal ions due to its thiol group at the end of the R chain[1]. For example its ability to bind to nickel ions.

References

  1. YCPSCRYPCFP RI, CPLCLFEFRE RT, TCPLCNAKLVY IE, QCPLCRCPVQ VS, PCPLCRVESLH CV, NVSCPQCRETFPQ RQ, DCNHSFCRACITLNYESNRNTDGKGNCPVCRVPYPF RI, ECPTCRKKLVS RS. A novel cysteine-rich sequence motif. Cell. 1991 Feb 8;64:483-4.
Personal tools
Namespaces
Variants
Actions
Navigation
Toolbox