Protein Analysis - Interpro
Home | Index | Assessment | Blog | Wiki
In this section we will run a Interpro search, to find functional domains in a protein.
Clean up
You can now close all the other windows (don't close this one).
Setting up the Interpro search
  1. Go to the Interpro site: http://www.ebi.ac.uk/interpro/search/sequence-search
MDAKHKNSTILGPIKAQIKAMADKVSKNALGLYHDIQVQHREYIVPISFLALILLTLANFLAGVYTFVWMLVAFKLSDVLDDVLFLRRLEKITSNVHALASNAYKQVLEESIAVESELYARFPHGEDSKQIAQIANKKKIDRWYLLDVSFRVKDKWHKKQGDMMDAKHKLGPIKAQIKAMADKVSKNALGLYHDIQVQHREYTFVWMLVAFKLSDVLDDVLFLRRLEKITSNVHALASNAYKQVLEESIAVESELYARFPHGEDSKQIAQIANKKKIDRWYLLDVSFRVKDKWHKKQGDM
(This is the same sequence as you used for the Prosite search)
  1. Copy the above sequence
  2. Paste the copied sequence into the search box at the Interpro site
The completed Interpro entry
  1. Click on the 'Search' button
Previous Page | Next Page