Protein Analysis - Prosite
Home | Index | Assessment | Blog | Wiki
In the last section you carried out a BLAST search with a protein, and it did not return any good hits. We will now analyse the protein using Prosite, Interpro, Pfam and SMART to see if we can find any additional information from the primary amino acid sequence. First, Prosite.
Prosite
Prosite can analyse a sequence for the presence of a number of motifs, including:
  1. Post-translational modifications
  2. Domains
  3. DNA or RNA associated proteins
  4. Enzymes
  5. Oxidoreductases
  6. Transferases
  7. Hydrolases
  8. Lyases
  9. Isomerases
  10. Ligases
  11. Electron transport proteins
  12. Other transport proteins
  13. Structural proteins
  14. Receptors
  15. Cytokines and growth factors
  16. Hormones and active peptides
  17. Toxins
  18. Inhibitors
  19. Protein secretion and chaperones
Running a Prosite search
  1. Go to the Prosite website at: http://prosite.expasy.org
  2. Copy the following sequence
MDAKHKNSTILGPIKAQIKAMADKVSKNALGLYHDIQVQHREYIVPISFLALILLTLANFLAGVYTFVWMLVAFKLSDVLDDVLFLRRLEKITSNVHALASNAYKQVLEESIAVESELYARFPHGEDSKQIAQIANKKKIDRWYLLDVSFRVKDKWHKKQGDMMDAKHKLGPIKAQIKAMADKVSKNALGLYHDIQVQHREYTFVWMLVAFKLSDVLDDVLFLRRLEKITSNVHALASNAYKQVLEESIAVESELYARFPHGEDSKQIAQIANKKKIDRWYLLDVSFRVKDKWHKKQGDM
  1. Paste the sequence into the Prosite search box
  2. Set 'Exclude motifs with a high probability of occurrence from the scan' to No (remove the tick - the window should look like the figure below)
Prosite setup
  1. Click on 'Scan'
Previous Page | Next Page