Protein Analysis - SMART
Home | Index | Assessment | Blog | Wiki
In this section, we will run a SMART search to find functional domains in a protein.
Clean up
You can now close all the other windows (don't close this one).
Setting up the SMART search
  1. Go to the SMART site: http://smart.embl-heidelberg.de/
The first time you go to the site you may see this:
The screen the first time you use SMART
  1. If the screen looks like above, then click on 'SMART MODE: NORMAL', i.e. the left-hand, panel.
MDAKHKNSTILGPIKAQIKAMADKVSKNALGLYHDIQVQHREYIVPISFLALILLTLANFLAGVYTFVWMLVAFKLSDVLDDVLFLRRLEKITSNVHALASNAYKQVLEESIAVESELYARFPHGEDSKQIAQIANKKKIDRWYLLDVSFRVKDKWHKKQGDMMDAKHKLGPIKAQIKAMADKVSKNALGLYHDIQVQHREYTFVWMLVAFKLSDVLDDVLFLRRLEKITSNVHALASNAYKQVLEESIAVESELYARFPHGEDSKQIAQIANKKKIDRWYLLDVSFRVKDKWHKKQGDM
(This is the same sequence as you used for the Prosite search)
  1. Copy the above sequence
  2. Paste the sequence into the search box at the SMART site
The completed SMART entry
  1. Click on the 'Sequence SMART' button
Previous Page | Next Page